PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014316-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 73aa    MW: 8414.07 Da    PI: 4.0266
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014316-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.65.1e-122466145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++ +T++E+ l+++   +lG + W++Ia +++ gRt++++  +w 
    NNU_014316-RA 24 KLEFTEDEETLIARMYSLLGDR-WSLIAGRIP-GRTAEEIEKYWT 66
                     689*****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.7041973IPR017930Myb domain
SMARTSM007176.1E-92371IPR001005SANT/Myb domain
PfamPF002491.0E-102566IPR001005SANT/Myb domain
SuperFamilySSF466891.48E-92669IPR009057Homeodomain-like
CDDcd001673.56E-82665No hitNo description
Gene3DG3DSA:1.10.10.607.9E-142667IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MADLDRSSDD TSVDSREDTS QDSKLEFTED EETLIARMYS LLGDRWSLIA GRIPGRTAEE  60
IEKYWTSRYS TSE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267757.14e-45PREDICTED: transcription factor CPC-like
SwissprotO220596e-18CPC_ARATH; Transcription factor CPC
TrEMBLD7TEM71e-37D7TEM7_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02360.t014e-37(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.11e-18MYB_related family protein